ZP3 Protein, Mouse, Recombinant (His)
Katalog-Nummer NB-64-127657-20ug
Size : 20ug
Marke : Neo Biotech
Remove All
ZP3 Protein, Mouse, Recombinant (His)
(Synonyms: Zpc, Zp-3, Zp3, Zona pellucida sperm-binding protein 3, Zona pellucida protein C, Zona pellucida glycoprotein 3 (Zp-3), Sperm receptor) Copy Product InfoSynonyms: Zpc, Zp-3, Zp3, Zona pellucida sperm-binding protein 3, Zona pellucida protein C, Zona pellucida glycoprotein 3 (Zp-3), Sperm receptor
Catalog No. TMPH-04362 Copy Product Info
ZP3 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P10761.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:85%
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | ZP3 Protein, Mouse, Recombinant (His) is expressed in E. coli with C-6xHis. The accession number is P10761. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | C-6xHis |
| Accession Number | P10761 |
| Amino Acid | QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRN |
| Construction | 23-351 aa |
| Protein Purity | >85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Zpc, Zp-3, Zp3, Zona pellucida sperm-binding protein 3, Zona pellucida protein C, Zona pellucida glycoprotein 3 (Zp-3), Sperm receptor |
| Molecular Weight | 43.2 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Zp 3
Related Tags: ZP3 Protein, Mouse, Recombinant (His) chemical structure | ZP3 Protein, Mouse, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote


