Frmd8 Blocking peptie (Middle region)

Cat# AAP95341

Size : 100ug

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

FRMD8 Peptide - middle region (AAP95341)

Data Sheet
 
Sku AAP95341
99
Name FRMD8 Peptide - middle region (AAP95341)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene FRMD8
Alias symbols AU018809, 1200004M23Rik, 2310035N23Rik, 4931429L16Rik
Gene id 67457
Description of target The function of this protein remains unknown.
Swissprot id Q3UFK8
Protein accession num NP_080445.1
Nucleotide accession num NM_026169.4
Protein size 466 amino acids
Molecular weight 51 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: RAVREVLQLPDVALEAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRF
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- FRMD8 Antibody (ARP95341_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com