Interleukin-4

Cat# NB-21-24892

Size : 50ug

Brand : Neo Biotech


Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P05112
Molecular weight:
16.20kDa
Gly24–Ser154 His

Specifications Interleukin-4

Product name Interleukin-4
Uniprot ID P05112
Uniprot link https://www.uniprot.org/uniprot/P05112
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC
Molecular weight 16.20kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >38% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Ser154
Protein Accession P05112
Spec:Entrez GeneID 3565
Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1
Spec:SwissProtID Q14630
NCBI Reference P05112
Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4
Reference PX-P4558
Note For research use only
Molecular Constructor
Gly24–Ser154 His
Product name Interleukin-4
Uniprot ID P05112
Uniprot link https://www.uniprot.org/uniprot/P05112
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC
Molecular weight 16.20kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >38% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Ser153
Protein Accession P05112
Spec:Entrez GeneID 3565
Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1
Spec:SwissProtID Q14630
NCBI Reference P05112
Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4
Reference PX-P4558
Note For research use only
Molecular Constructor
Gly24–Ser154 His
Product name PX-P4558-1MG
Uniprot ID P05112
Uniprot link https://www.uniprot.org/uniprot/P05112
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKC
Molecular weight 16.20kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >38% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly24-Ser154
Protein Accession P05112
Spec:Entrez GeneID 3565
Spec:NCBI Gene Aliases BSF1; IL-4; BCGF1; BSF-1; BCGF-1
Spec:SwissProtID Q14630
NCBI Reference P05112
Aliases /Synonyms B-cell stimulatory factor 1、BSF-1、Binetrakin、Lymphocyte stimulatory factor 1、Pitrakinra, IL4, IL-4
Reference PX-P4558
Note For research use only
Molecular Constructor
Gly24–Ser154 His

Documents

3D Representation

Interleukin-4

Reviews

There are no reviews yet.

Be the first to review “Interleukin-4” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody