Pro-epidermal growth factor(EGF)

Cat# NB-21-25093

Size : 100ug

Brand : Neo Biotech


Host species:
Escherichia coli (E.coli)
Uniprot ID:
P01133
Molecular weight:
18.3kDa
His Met608–Gly751

Specifications Pro-epidermal growth factor(EGF)

Product name Pro-epidermal Growth Factor proteins(EGF)
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751
Product name Pro-epidermal Growth Factor proteins(EGF)
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751
Product name PX-P4822-1MG
Uniprot ID P01133
Uniprot link https://www.uniprot.org/uniprot/P01133
Expression system Prokaryotic expression
Raw Antigen Sequence MAKRLFWTDTGINPRIESSSLQGLGRLVIASSDLIWPSGITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDYVWFSDWAMPSVMRVNKRTGKDRVRLQGSMLKPSSLVVVHPLAKPGADPCLYQNGG
Molecular weight 18.3kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Met608-Gly751
Protein Accession P01133
Spec:Entrez GeneID 1950
Spec:NCBI Gene Aliases URG; HOMG4
Spec:SwissProtID Q52LZ6
NCBI Reference P01133
Aliases /Synonyms /
Reference PX-P4822
Note For research use only
Molecular Constructor
His Met608–Gly751

Documents

3D Representation

Pro-epidermal growth factor(EGF)

Reviews

There are no reviews yet.

Be the first to review “Pro-epidermal growth factor(EGF)” Cancel reply

Related products

  • SDS-PAGE for Bevacizumab Biosimilar - Anti-VEGF mAb

    PX-TA1006

    Bevacizumab Biosimilar – Anti-VEGF mAb – Research Grade