PTDSS2 antibody - N-terminal region

Cat# ARP49960_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-PTDSS2 (ARP49960_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE
Concentration0.5 mg/ml
Blocking PeptideFor anti-PTDSS2 (ARP49960_P050) antibody is Catalog # AAP49960 (Previous Catalog # AAPP44252)
Sample Type Confirmation

PTDSS2 is supported by BioGPS gene expression data to be expressed in HEK293T

Publications

Deficient Endoplasmic Reticulum-Mitochondrial Phosphatidylserine Transfer Causes Liver Disease. Cell. 177, 881-895.e17 (2019). 31051106

Description
Gene SymbolPTDSS2
Gene Full NamePhosphatidylserine synthase 2
Alias SymbolsPSS2
NCBI Gene Id81490
Protein NamePhosphatidylserine synthase 2
Description of TargetPhosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).
Uniprot IDQ9BVG9
Protein Accession #NP_110410
Nucleotide Accession #NM_030783
Protein Size (# AA)487
Molecular Weight56kDa
Protein InteractionsHNRNPR; ILF3; UBC;
  1. What is the species homology for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PTDSS2 Antibody - N-terminal region (ARP49960_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    This target may also be called "PSS2" in publications.

  5. What is the shipping cost for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PTDSS2 Antibody - N-terminal region (ARP49960_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTDSS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTDSS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTDSS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTDSS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTDSS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTDSS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
ARP47068_P050
 100ul 
LS-C163519-400
 400ul