fr en es de it pt nl

Reagents and instruments for immunology, cell biology and molecular biology.

Recombinant Human Cytokine receptor common subunit gamma(IL2RG)

Print

Cat# orb2902566-100ug

Size : 100ug

Brand : Biorbyt

Request more information

Recombinant Human Cytokine receptor common subunit gamma(IL2RG)

SKU: orb2902566

This product can be custom made

Description

This Recombinant Human Cytokine receptor common subunit gamma(IL2RG) spans the amino acid sequence from region 23-369.

Research Area

Immunology & Inflammation

Images & Validation

−

Key Properties

−

Biological Origin	Homo sapiens (Human)
Expression Region	23-369
Protein Length	full length protein
Protein Sequence	LNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCT This product can not be ordered from your electronic catalog. A quotation will be created for this reference, would you like to continue? In this case, make sure that you have filled in the desired quantity Email c/o Carr Riggs Ingram, 500 Grand Boulevard, Suite 210 Miramar Beach, FL 32550 - USA Tel.: +1 850 650 7790 Fax: +1 850 650 4383 Email: usa@clinisciences.com >> Worldwide offices and Distributors >> Other information How to order ? Terms and conditions Job vacancies Who are we ? Newsletter Quality policies Events Legal notice All trademarks or registered trademarks appearing on this website are the property of their respective owners fr en es de it pt nl