Recombinant Human TRPV1, N-His

Specifications Recombinant Human TRPV1, N-His

Product name	ARO-P13237-100
Uniprot ID	Q8NER1
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPE
Molecular weight	19.05 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Glu153
Aliases /Synonyms	VR1, Vanilloid receptor 1, Transient receptor potential cation channel subfamily V member 1, Capsaicin receptor, Osm-9-like TRP channel 1, TrpV1, TRPV1, OTRPC1
Reference	ARO-P13237
Note	For research use only.
Molecular Constructor	Met1–Glu153

Product name	ARO-P13237-1MG
Uniprot ID	Q8NER1
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPE
Molecular weight	19.05 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Glu153
Aliases /Synonyms	VR1, Vanilloid receptor 1, Transient receptor potential cation channel subfamily V member 1, Capsaicin receptor, Osm-9-like TRP channel 1, TrpV1, TRPV1, OTRPC1
Reference	ARO-P13237
Note	For research use only.
Molecular Constructor	Met1–Glu153

Product name	ARO-P13237-50
Uniprot ID	Q8NER1
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPE
Molecular weight	19.05 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met1-Glu153
Aliases /Synonyms	VR1, Vanilloid receptor 1, Transient receptor potential cation channel subfamily V member 1, Capsaicin receptor, Osm-9-like TRP channel 1, TrpV1, TRPV1, OTRPC1
Reference	ARO-P13237
Note	For research use only.
Molecular Constructor	Met1–Glu153

Documents

• Datasheet

QC & Validation

SDS-PAGE for Recombinant Human TRPV1, N-His

Recombinant Human TRPV1, N-His, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human TRPV1, N-His” Cancel reply