ASM10289-A680-100 | Ataxin 1 Antibody Clinisciences

Immunocytochemistry/Immunofluorescence analysis using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (ASM10289). Tissue: Neuroblastoma cell line (SK-N-BE). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (ASM10289) at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X.
Western Blot analysis of Monkey COS-1 cells transfected with Ataxin- 1 showing detection of ~85 kDa Ataxin 1 protein using Mouse Anti-Ataxin 1 Monoclonal Antibody, Clone S76-8 (ASM10289). Lane 1: Molecular Weight Ladder. Lane 2: Monkey COS-1 cells transfected with Ataxin- 1. Load: 15 µg. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-Ataxin 1 Monoclonal Antibody (ASM10289) at 1:200 for 16 hours at 4°C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:1000 for 1 hour RT. Color Development: ECL solution for 6 min in RT. Predicted/Observed Size: ~85 kDa.

Product Information
Application Applications Legend: WB=Western Blot IHC=Immunohistochemistry IHC-P=Immunohistochemistry (Paraffin-embedded Sections) IHC-F=Immunohistochemistry (Frozen Sections) IF=Immunofluorescence FC=Flow Cytopmetry IC=Immunochemistry ICC=Immunocytochemistry E=ELISA IP=Immunoprecipitation DB=Dot Blot CHIP=Chromatin Immunoprecipitation FA=Fluorescence Assay IEM=Immunoelectronmicroscopy EIA=Enzyme Immunoassay	WB, IHC, ICC/IF, IP
Primary Accession	P54254
Other Accession	NP_001186233.1
Host	Mouse
Isotype	IgG2b
Reactivity	Human, Mouse, Rat
Clonality	Monoclonal
Description	Mouse Anti-Mouse Ataxin 1 Monoclonal IgG2b
Target/Specificity	Detects ~85kDa.
Other Names	Ataxin-1 Antibody, ATX1 Antibody, Atxn1 Antibody, D6S504E Antibody, OTTHUMP00000016065 Antibody, SCA1 Antibody, Spinocerebellar ataxia type 1 protein Antibody
Clone Names	S76-8
Immunogen	Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
Purification	Protein G Purified
Storage	-20ºC
Storage Buffer	PBS pH 7.4, 50% glycerol, 0.1% sodium azide
Shipping Temperature	Blue Ice or 4ºC
Certificate of Analysis	1 µg/ml of SMC-455 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.
Cellular Localization	Cytoplasm \| Nucleus

Ataxin 1 Antibody