ARO-A14819
Size : 100µg
| Product name | ARO-P11492-100 |
|---|---|
| Uniprot ID | P02754 |
| Origin species | Bovine |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI |
| Molecular weight | 21.59 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu17-Ile178 |
| Aliases /Synonyms | Beta-lactoglobulin, Beta-LG, Bos d 5, LGB |
| Reference | ARO-P11492 |
| Note | For research use only. |
| Molecular Constructor | Leu17–Ile178 |
| Product name | ARO-P11492-1MG |
|---|---|
| Uniprot ID | P02754 |
| Origin species | Bovine |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI |
| Molecular weight | 21.59 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu17-Ile178 |
| Aliases /Synonyms | Beta-lactoglobulin, Beta-LG, Bos d 5, LGB |
| Reference | ARO-P11492 |
| Note | For research use only. |
| Molecular Constructor | Leu17–Ile178 |
| Product name | ARO-P11492-50 |
|---|---|
| Uniprot ID | P02754 |
| Origin species | Bovine |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI |
| Molecular weight | 21.59 kDa |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Leu17-Ile178 |
| Aliases /Synonyms | Beta-lactoglobulin, Beta-LG, Bos d 5, LGB |
| Reference | ARO-P11492 |
| Note | For research use only. |
| Molecular Constructor | Leu17–Ile178 |
ARO-A14819
There are no reviews yet.