Reagents and instruments for immunology, cell biology and molecular biology.
 
> Anti-Human DMC1 Polyclonal Antibody

Anti-Human DMC1 Polyclonal Antibody

Print Print
Please log in

Cat# NB-21-37438

Size : 100µg

Brand : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

Specifications Anti-Human DMC1 Polyclonal Antibody

Product name ARO-A12009-100
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).
Product name ARO-A12009-1MG
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).
Product name ARO-A12009-50
Uniprot ID Q14565
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-A12009
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human DMC1 (Asp23-Glu340).

Documents

QC & Validation

Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

Recombinant Human DMC1 Protein, N-His(cat. No.ARO-P11849) can bind Anti-Human DMC1 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human DMC1 Polyclonal Antibody” Cancel reply

Related products

  • Recombinant Human DMC1 Protein, N-His

    ARO-P11849

    Recombinant Human DMC1 Protein, N-His