Reagents and instruments for immunology, cell biology and molecular biology.
 
> BTNL3 antibody - N-terminal region

BTNL3 antibody - N-terminal region

Print Print
Please log in

Cat# ARP46769_P050

Size : 100ul

Brand : Aviva Systems Biology

Contact local distributor :


Phone : +1 850 650 7790

Rating:
80% of 100
  • ELISA Titer: 1:312500
    Positive Control: Human LungHuman Lung
  • Target Name: NOP56
    Sample Type: Human Fetal Muscle
    Antibody Dilution: 1.0ug/mlHuman Fetal Muscle
  • Target Name: GNAS
    Sample Type: Human Fetal Heart
    Antibody Dilution: 1.0ug/mlHuman Fetal Heart
Datasheets/ManualsPrintable datasheet for anti-BTNL3 (ARP46769_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human BTNL3
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Horse: 77%; Human: 100%; Pig: 77%
Peptide SequenceSynthetic peptide located within the following region: EDWESKQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQI
Concentration0.5 mg/ml
Blocking PeptideFor anti-BTNL3 (ARP46769_P050) antibody is Catalog # AAP46769 (Previous Catalog # AAPP27568)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceClark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Publications

Butyrophilin-like 3 Directly Binds a Human Vγ4+ T Cell Receptor Using a Modality Distinct from Clonally-Restricted Antigen. Immunity. 51, 813-825.e4 (2019). 31628053

Description
Gene SymbolBTNL3
Gene Full NameButyrophilin-like 3
Alias SymbolsBTNLR, BTN9.1
NCBI Gene Id10917
Protein NameButyrophilin-like protein 3
Description of TargetThe specific function of BTNL3 is not yet known.
Uniprot IDQ6UXE8
Protein Accession #NP_932079
Nucleotide Accession #NM_197975
Protein Size (# AA)466
Molecular Weight52 kDa
Biological pathways
Name# of Products
Lipid metabolic process106
Biological process
Name# of Products
Lipid metabolic process172
Cellular components
Name# of Products
Integral to membrane2793
Membrane2769

  1. What is the species homology for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Horse, Pig".

  2. How long will it take to receive "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BTNL3 Antibody - N-terminal region (ARP46769_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    This target may also be called "BTNLR, BTN9.1" in publications.

  5. What is the shipping cost for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "52 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BTNL3 Antibody - N-terminal region (ARP46769_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BTNL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BTNL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BTNL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BTNL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BTNL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BTNL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

You might also be interested by the following products:



Cat#
Description
Cond.
Price Bef. VAT
OACA05155-100UG
BTNL3 Antibody
 100ug 
OACA05155-50UG
BTNL3 Antibody
 50ug