Lingual Antimicrobial Peptide, Recombinant, Bubalus bubalis, aa25-64, His-KSI-Tag
Cat# 585199-20ug
Size : 20ug
Brand : US Biological
585199 Lingual Antimicrobial Peptide, Recombinant, Bubalus bubalis, aa25-64, His-KSI-Tag
Swiss Prot
A3RJ36Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CHas bactericidal activity.
Source:
Recombinant protein corresponding to aa25-64 from Bubalus bubalis Lingual antimicrobial peptide, fused to 6X His-KSI-Tag at N-terminal, expressed in E.coli.
Molecular Weight:
~19.8kD
Amino Acid Sequence:
VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Applications
Source: Recombinant, E. coli|Purity: ≥85% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)