Reagents and instruments for immunology, cell biology and molecular biology.
 
> Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158

Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158

Print Print
Please log in

Cat# 585220-20ug

Size : 20ug

Brand : US Biological


585220 Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158

Swiss Prot
P24666
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.

Source:
Recombinant protein corresponding to aa1-158 from human Low molecular weight phosphotyrosine protein phosphatase, expressed in E.coli.

Molecular Weight:
~18.0kD

Amino Acid Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)