Mouse CD133 protein
Cat# orb418982-20ug
Size : 20ug
Brand : Biorbyt
Contact local distributor :
Phone : +1 850 650 7790
Mouse CD133 protein
Catalog Number: orb418982
| Catalog Number | orb418982 |
|---|---|
| Category | Proteins |
| Description | Recombinant Mouse Prominin-1 |
| Tag | N-terminal 6XHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 48.5 kDa |
| UniProt ID | O54990 |
| Protein Sequence | GANVEKLLCEPYENKKLLQVLDTPYLLKEQWQFYLSGMLFNNPDINMTFEQVYRDCKRGRGIYAAFQLENVVNVSDHFNIDQISENINTELENLNVNIDSIELLDNTGRKSLEDFAHSGIDTIDYSTYLKETEKSPTEVNLLTFASTLEAKANQLPEGKPKQAFLLDVQNIRAIHQHLLPPVQQSLNTLRQSVWTLQQTSNKLPEKVKKILASLDSVQHFLTNNVSLIVIGETKKFGKTILGYFEHYLHWVFYAITEKMTSCKPMATAMDSAVNGILCGYVADPLN |
| Protein Length | Extracellular Domain |
| Source | E.coli |
| Expression System | Expression Region: 509-794aa. Protein Length: Extracellular Domain |
| Expression Region | 509-794aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Antigen AC133 homolog Prominin-like protein 1 CD_a |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6XHis-SUMO-taggedExpression Region: 509-794aaSequence Info: Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |