Gja3 Blocking peptide (C terminal region)

Referencia AAP97779

embalaje : 100ug

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

GJA3 Peptide - C-terminal region (AAP97779)

Data Sheet
 
Sku AAP97779
99
Name GJA3 Peptide - C-terminal region (AAP97779)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene GJA3
Alias symbols Cx43, Cx46, Cnx46, Gja-3
Gene id 14611
Description of target One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Swissprot id Q64448
Protein accession num NP_001258552.1
Nucleotide accession num NM_001271623.1
Protein size 417 amino acids
Molecular weight 45 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: LQESALVVTPEEGEQALATTVEMHSPPLVLLDPGRSSKSSNGRARPGDLA
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- GJA3 Antibody (ARP97779_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com