Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Rabbit Polyclonal Anti-IL33 Antibody

Rabbit Polyclonal Anti-IL33 Antibody

Imprimir Imprimir
Por favor conéctese

Referencia TA339875

embalaje : 100ul

Solicitar más información

Contact local distributor :


Teléfono :

IL33 Rabbit Polyclonal Antibody

main product photo
SKU
TA339875
Rabbit Polyclonal Anti-IL33 Antibody

Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-IL33 antibody: synthetic peptide directed towards the N terminal of human IL33. Synthetic peptide located within the following region: AKEVCPMYFMKLRSGLMIKKEACYFRRETTKRPSLKTGRKHKRHLVLAAC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name interleukin 33
Database Link
Background Cytokine that binds to and signals through IL1RL1/ST2 and its stimulation recruits MYD88, IRAK1, IRAK4, and TRAF6, followed by phosphorylation of MAPK3/ERK1 and/or MAPK1/ERK2, MAPK14, and MAPK8. IL33 induces T helper type 2-associated cytokines.
Synonyms C9orf26; DVS27; IL1F11; NF-HEV; NFEHEV
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein
Protein Pathways Cytosolic DNA-sensing pathway
Product Manuals
FAQs
  • Antibody and Western Standard
SDS
Antibody Resources