SIRT1 Blocking peptide (Middle region)

Referencia AAP97279

embalaje : 100ug

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

SIRT1 Peptide - middle region (AAP97279)

Data Sheet
 
Sku AAP97279
99
Name SIRT1 Peptide - middle region (AAP97279)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SIRT1
Alias symbols SIR2, SIR2L1, SIR2alpha
Gene id 23411
Description of target This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class I of the sirtuin family. Alternative splicing results in multiple transcript variants.
Swissprot id Q96EB6
Protein accession num NP_001135970.1
Nucleotide accession num NM_001142498.1
Protein size 747 amino acids
Molecular weight 82 kDa
Species reactivity Human
Peptide sequence Synthetic peptide located within the following region: VSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQ
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SIRT1 Antibody (ARP97279_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com