SLC1A3 Protein, Human, Recombinant (His)
Referencia NB-64-166738-20ug
embalaje : 20ug
Marca : Neo Biotech
Remove All
SLC1A3 Protein, Human, Recombinant (His)
(Synonyms: SLC1A3, GLAST-1, GLAST1, GLAST, EAAT1) Copy Product InfoSynonyms: SLC1A3, GLAST-1, GLAST1, GLAST, EAAT1
Catalog No. TMPH-04809 Copy Product Info
SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:90%
Appearance:Lyophilized powder
Color:White
Contact us for more batch information
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | SLC1A3 Protein, Human, Recombinant (His) is expressed in Yeast. The accession number is P43003. |
| Species | Human |
| Expression System | Yeast |
| Tag | C-6xHis |
| Accession Number | P43003 |
| Amino Acid | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
| Construction | 146-236 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4. |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | SLC1A3, GLAST-1, GLAST1, GLAST, EAAT1 |
| Molecular Weight | 11.7 kDa (Predicted); 25-55kDa (Reducing conditions due to glycosylation) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
SLC1A3Protein,Human,Recombinant(His)
Related Tags: SLC1A3 Protein, Human, Recombinant (His) chemical structure | SLC1A3 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote


