Reactivos e instrumentos para inmunología, biología celular y biología molecular.
 
> Fibroblast growth factor 21(FGF21)(29-209)

Fibroblast growth factor 21(FGF21)(29-209)

Imprimir Imprimir
Por favor conéctese

Referencia NB-21-24581

embalaje : 50ug

Marca : Neo Biotech


Fibroblast growth factor 21(FGF21)(29-209)

Product name Fibroblast Growth Factor proteins 21(FGF21)(29-209)
Uniprot ID Q9NSA1
Uniprot link https://www.uniprot.org/uniprot/Q9NSA1
Expression system Prokaryotic expression
Raw Antigen Sequence HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
Molecular weight 20.61kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type His29-Ser209
Protein Accession Q9NSA1
Spec:Entrez GeneID 26291
Spec:SwissProtID Q8N683
NCBI Reference Q9NSA1
Aliases /Synonyms FGF-21
Reference PX-P4734
Note For research use only
Molecular Constructor
His His29–Ser209