Slc25a18 Blocking peptide (Middle region)

Referencia AAP94221

embalaje : 100ug

Marca : Aviva Systems Biology

Contact local distributor :


Teléfono : +1 850 650 7790

SLC25A18 Peptide - middle region (AAP94221)

Data Sheet
 
Sku AAP94221
99
Name SLC25A18 Peptide - middle region (AAP94221)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene SLC25A18
Alias symbols AW125787, 1500015I14Rik
Gene id 71803
Description of target Involved in the transport of glutamate across the inner mitochondrial membrane. Glutamate is cotransported with H+ (By similarity).
Swissprot id Q9DB41
Protein accession num NP_001074517.1
Nucleotide accession num NM_001081048.2
Protein size 320 amino acids
Molecular weight 35 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: GCTAGSVAAVAVTPLDVLKTRIQTLKKGLGEDTYSGVTDCARKLWTQEGP
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- SLC25A18 Antibody (ARP94221_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com