Recombinant Human POU5F1/OCT3/OCT4, N-His

Specifications Recombinant Human POU5F1/OCT3/OCT4, N-His

Product name	ARO-P13523-100
Uniprot ID	Q01860
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight	20.18 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser136-Ser289
Aliases /Synonyms	Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference	ARO-P13523
Note	For research use only.
Molecular Constructor	Ser136–Ser289

Product name	ARO-P13523-1MG
Uniprot ID	Q01860
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight	20.18 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser136-Ser289
Aliases /Synonyms	Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference	ARO-P13523
Note	For research use only.
Molecular Constructor	Ser136–Ser289

Product name	ARO-P13523-50
Uniprot ID	Q01860
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	SQDIKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKLRPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFLQCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSS
Molecular weight	20.18 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Ser136-Ser289
Aliases /Synonyms	Octamer-binding protein 4, Oct-4, OCT3, OCT4, OTF3, OTF-3, Octamer-binding transcription factor 3, POU5F1, Oct-3, POU domain, class 5, transcription factor 1, Octamer-binding protein 3
Reference	ARO-P13523
Note	For research use only.
Molecular Constructor	Ser136–Ser289

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human POU5F1/OCT3/OCT4, N-His” Cancel reply