Estrogen receptor (in E.coli)

Specifications Estrogen receptor (in E.coli)

Product name	Estrogen receptor (in E.coli)
Uniprot ID	P03372
Uniprot link	https://www.uniprot.org/uniprot/P03372
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight	29.47 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met297-Ser554
Protein Accession	P03372
Spec:Entrez GeneID	2099
Spec:NCBI Gene Aliases	ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID	Q9UIS7
NCBI Reference	P03372
Aliases /Synonyms	ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference	PX-P4797
Note	For research use only
Molecular Constructor	Met297–Ser554 N terminus His

Product name	Estrogen receptor (in E.coli)
Uniprot ID	P03372
Uniprot link	https://www.uniprot.org/uniprot/P03372
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight	29.47 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met297-Ser554
Protein Accession	P03372
Spec:Entrez GeneID	2099
Spec:NCBI Gene Aliases	ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID	Q9UIS7
NCBI Reference	P03372
Aliases /Synonyms	ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference	PX-P4797
Note	For research use only
Molecular Constructor	Met297–Ser554 N terminus His

Product name	PX-P4797-1MG
Uniprot ID	P03372
Uniprot link	https://www.uniprot.org/uniprot/P03372
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	MIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTS
Molecular weight	29.47 kDa
Protein delivered with Tag?	N terminus His tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Met297-Ser554
Protein Accession	P03372
Spec:Entrez GeneID	2099
Spec:NCBI Gene Aliases	ER; ESR; Era; ESRA; ESTRR; NR3A1
Spec:SwissProtID	Q9UIS7
NCBI Reference	P03372
Aliases /Synonyms	ER, ER-alpha,Estradiol receptor,Nuclear receptor subfamily 3 group A member 1,ESR, NR3A1
Reference	PX-P4797
Note	For research use only
Molecular Constructor	Met297–Ser554 N terminus His

Documents

• Datasheet
• MSDS

QC & Validation

SDS-PAGE for Estrogen receptor (in E.coli)

Estrogen receptor (in E.coli), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Estrogen receptor (in E.coli)” Cancel reply