Fibroblast growth factor 1(FGF1) (16-155)

Cat# NB-21-24579

Size : 50ug

Marca : Neo Biotech


Fibroblast growth factor 1(FGF1) (16-155)

Product name Fibroblast Growth Factor proteins 1(FGF1) (16-155)
Uniprot ID P05230
Uniprot link https://www.uniprot.org/uniprot/P05230
Expression system Prokaryotic expression
Raw Antigen Sequence FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Molecular weight 17kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Phe16~Asp155
Protein Accession P05230
Spec:Entrez GeneID 2246
Spec:NCBI Gene Aliases AFGF; ECGF; FGFA; ECGFA; ECGFB; FGF-1; HBGF1; HBGF-1; GLIO703; ECGF-beta; FGF-alpha
Spec:SwissProtID Q16588
NCBI Reference P05230
Aliases /Synonyms FGFA,aFGF,ECGF,HBGF-1
Reference PX-P4884
Note For research use only
Molecular Constructor
Phe16~Asp155 His