Reagenti e strumenti per immunologia, biologia cellulare e biologia molecolare
 
> HLAA (HLA-A) (NM_002116) Human Recombinant Protein

HLAA (HLA-A) (NM_002116) Human Recombinant Protein

Stampa Stampa
Entra

Cat# TP300661

Size : 20ug


HLAA (HLA-A) (NM_002116) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300661
Recombinant protein of human major histocompatibility complex, class I, A (HLA-A), 20 µg
 

Other products for "HLAA or NM_002116"

Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200661 protein sequence
Red=Cloning site Green=Tags(s)

MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQD
AYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPK
THMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQR
YTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASS
DSAQGSDVSLTACKV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_002107
Locus ID 3105
UniProt ID P04439
Cytogenetics 6p22.1
RefSeq Size 1636
RefSeq ORF 1095
Synonyms HLAA
Summary HLA-A belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen so that they can be recognized by cytotoxic T cells. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. More than 6000 HLA-A alleles have been described. The HLA system plays an important role in the occurrence and outcome of infectious diseases, including those caused by the malaria parasite, the human immunodeficiency virus (HIV), and the severe acute respiratory syndrome coronavirus (SARS-CoV). The structural spike and the nucleocapsid proteins of the novel coronavirus SARS-CoV-2, which causes coronavirus disease 2019 (COVID-19), are reported to contain multiple Class I epitopes with predicted HLA restrictions. Individual HLA genetic variation may help explain different immune responses to a virus across a population.provided by RefSeq, Aug 2020
Protein Categories Cytokines, Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Protein Pathways Allograft rejection, Antigen processing and presentation, Autoimmune thyroid disease, Cell adhesion molecules (CAMs), Endocytosis, Graft-versus-host disease, Natural killer cell mediated cytotoxicity, Type I diabetes mellitus, Viral myocarditis
FAQs
  • Protein FAQs
SDS
SKU Description Size
PH300661 HLA MS Standard C13 and N15-labeled recombinant protein (NP_002107) 10 ug
LC400771 Lyophilized HLA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY400771 Transient overexpression lysate of major histocompatibility complex, class I, A (HLA-A) (as WB positive control) 100 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced