HPDL Antibody : HRP

Cat# ARP60658_P050-HRP

Size : 100ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-HPDL (ARP60658_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HPDL
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: LEMTAGFGLGGLRLTALQAQPGSIVPTLVLAESLPGATTRQDQVEQFLAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-HPDL (ARP60658_P050) antibody is Catalog # AAP60658
Gene SymbolHPDL
Gene Full Name4-hydroxyphenylpyruvate dioxygenase like
Alias SymbolsSPG83, GLOXD1, NEDSWMA, 4-HPPD-L
NCBI Gene Id84842
Protein Name4-hydroxyphenylpyruvate dioxygenase-like protein
Description of TargetMay have dioxygenase activity.
Uniprot IDQ96IR7
Protein Accession #NP_116145
Nucleotide Accession #NM_032756.2
Protein Size (# AA)371
Molecular Weight40 kDa
Protein InteractionsMDM2; LSM12; TMEM177; RIF1; TACO1; NUSAP1; HTRA2; TOR1AIP1; SUCLA2; TST; TCOF1; MECP2; M6PR; STMN1; EPHX1;
  1. What is the species homology for "HPDL Antibody - middle region (ARP60658_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "HPDL Antibody - middle region (ARP60658_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "HPDL Antibody - middle region (ARP60658_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HPDL Antibody - middle region (ARP60658_P050)"?

    This target may also be called "SPG83, GLOXD1, NEDSWMA, 4-HPPD-L" in publications.

  5. What is the shipping cost for "HPDL Antibody - middle region (ARP60658_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "HPDL Antibody - middle region (ARP60658_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HPDL Antibody - middle region (ARP60658_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "40 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HPDL Antibody - middle region (ARP60658_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HPDL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HPDL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HPDL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HPDL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HPDL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HPDL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.