Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: Q12884 Molecular weight: 27.55 kDa Ile523–Asp760 His Datasheet MSDS Specifications Human FAP protein (Ile523-Asp760) Product name Human FAP protein Uniprot ID Q12884 Uniprot link https://www.uniprot.org/uniprot/Q12884 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD Molecular weight 27.55 kDa Protein delivered with Tag? His Tag Purity estimated >90% Buffer PBS,pH7.5 Form Frozen Liquid or Lyophilized Delivery condition Dry Ice Delivery lead time in business days 10-25 Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ile523-Asp760 Spec:Entrez GeneID 2191 Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha Spec:SwissProtID Q12884 Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase Reference PX-P4887 Note For research use only Molecular Constructor Ile523–Asp760 His Product name Human FAP protein Uniprot ID Q12884 Uniprot link https://www.uniprot.org/uniprot/Q12884 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence ILPPQFDRSKKYPLLIQVYGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNAQVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD Molecular weight 27.55 kDa Protein delivered with Tag? His Tag Purity estimated >90% Buffer PBS,pH7.5 Form Frozen Liquid or Lyophilized Delivery condition Dry Ice Delivery lead time in business days 10-25 Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Ile523-Asp760 Spec:Entrez GeneID 2191 Spec:NCBI Gene Aliases FAPA; SIMP; DPPIV; FAPalpha Spec:SwissProtID Q12884 Aliases /Synonyms Prolyl endopeptidase FAP,Prolyl endopeptidase FAP,Dipeptidyl peptidase FAP,Fibroblast activation protein alpha,FAPalpha,Gelatine degradation protease FAP,Integral membrane serine protease,Post-proline cleaving enzyme,Serine integral membrane protease,SIMP,Surface-expressed protease,Seprase Reference PX-P4887 Note For research use only Molecular Constructor Ile523–Asp760 His Description General information on Human FAP protein Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “Human FAP protein (Ile523-Asp760)” Cancel reply
There are no reviews yet.