Human Vasoactive Intestinal Peptide, VIP Recombinant Protein, C-6His
Cat# orb1648851-50ug
Size : 50ug
Marca : Biorbyt
Human Vasoactive Intestinal Peptide, VIP Recombinant Protein, C-6His
SKU: orb1648851
Description
Images & Validation
−
Key Properties
−| Species/Host | Human |
|---|---|
| MW | 15.9kDa |
| Purity | Greater than 95% as determined by reducing SDS-PAGE. |
| Protein Sequence | SQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDMLQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGVDHHHHHH |
Storage & Handling
−| Storage | Lyophilized protein should be stored at < -2°C, though stable at room temperature for 3 weeks.; Reconstituted protein solution can be stored at 4-7C for 2-7 days.; Aliquots of reconstituted samples are stable at < -2°C for 3 months. |
|---|---|
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
−
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide