Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, aa’s and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.

Recombinant protein corresponding to aa25-108 from mouse Insulin-1, fused to 10X His-tag at N-terminal and Myc-tag at C-terminal, expressed in E. coli. Swiss/UniProt Accession: P01325.

Molecular Weight:
~14.5kD

Amino Acid Sequence:
FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.