LRRC47 Peptide - middle region

Cat# AAP95287

Size : 100ug

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

LRRC47 Peptide - middle region (AAP95287)

Data Sheet
 
Sku AAP95287
99
Name LRRC47 Peptide - middle region (AAP95287)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene LRRC47
Alias symbols AA960559, mKIAA1185, 2900010D03Rik
Gene id 72946
Description of target The function of this protein remains unknown.
Swissprot id Q505F5
Protein accession num NP_957678.1
Nucleotide accession num NM_201226.1
Protein size 581 amino acids
Molecular weight 63 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: KELVRQLQLEAEEQRKQKKRQSVSGLHRYLHLLDGKENYPCLVDAEGDVI
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- LRRC47 Antibody (ARP95287_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6350 Nancy Ridge Dr, Suite 106, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com