Mal d 1 Protein, Malus domestica, Recombinant (His & SUMO)
Cat# TMPH-02449-500ug
Size : 500ug
Marca : TargetMol
Mal d 1 Protein, Malus domestica, Recombinant (His & SUMO)
(Synonyms: MALD1, Major allergen Mal d 1, Allergen Mal d I) Copy Product InfoMal d 1 Protein, Malus domestica, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 33.5 kDa and the accession number is P43211.
User Guide of Recombinant Proteins
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Mal d 1 Protein, Malus domestica, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 33.5 kDa and the accession number is P43211. |
| Species | Apple |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P43211 |
| Amino Acid | GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN |
| Construction | 2-159 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | MALD1, Major allergen Mal d 1, Allergen Mal d I |
| Molecular Weight | 33.5 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |


