Reagenti e strumenti per immunologia, biologia cellulare e biologia molecolare
 
> PARP11 Antibody - middle region

PARP11 Antibody - middle region

Stampa Stampa
Entra

Cat# ARP33767_P050-25UL

Size : 25ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

  • ELISA Titer: 1:312500
    Positive Control: Human MuscleHuman Muscle
Datasheets/ManualsPrintable datasheet for anti-PARP11 (ARP33767_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PARP11
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: IKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKD
Concentration0.5 mg/ml
Blocking PeptideFor anti-PARP11 (ARP33767_P050) antibody is Catalog # AAP33767 (Previous Catalog # AAPP04833)
ReferenceScherer,S.E., (2006) Nature 440 (7082), 346-351
Gene SymbolPARP11
Gene Full NamePoly (ADP-ribose) polymerase family, member 11
Alias SymbolsARTD11, MIB006, C12orf6
NCBI Gene Id57097
Protein NamePoly [ADP-ribose] polymerase 11
Description of TargetPARP1 encodes a chromatin-associated enzyme, poly(ADP-ribosyl)transferase, which modifies various nuclear proteins by poly(ADP-ribosyl)ation. The modification is dependent on DNA and is involved in the regulation of various important cellular processes such as differentiation, proliferation, and tumor transformation and also in the regulation of the molecular events involved in the recovery of cell from DNA damage. In addition, this enzyme may be the site of mutation in Fanconi anemia, and may participate in the pathophysiology of type I diabetes. PARP1 can be cleaved resulting in fragements of 29 and 85 kDa.
Uniprot IDQ9NR21
Protein Accession #NP_065100
Nucleotide Accession #NM_020367
Protein Size (# AA)331
Molecular Weight39kDa
Protein InteractionsMDFI; TRIP13; DCAF11; RNF114; OTUD4; LYZ; GTPBP3; NUP98;
Protein interactions
Name# of Products
DCAF116
GTPBP36
LYZ35
NUP9844
OTUD458
RNF11431
Biological pathways
Name# of Products
Cellular response to insulin stimulus72
Protein ADP-ribosylation32
Regulation of transcription, DNA-dependent1489
Transcription from RNA polymerase II promoter338
Protein function
Name# of Products
NAD+ ADP-ribosyltransferase activity68
Transferase activity, transferring glycosyl groups257

  1. What is the species homology for "PARP11 Antibody - middle region (ARP33767_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "PARP11 Antibody - middle region (ARP33767_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PARP11 Antibody - middle region (ARP33767_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PARP11 Antibody - middle region (ARP33767_P050)"?

    This target may also be called "ARTD11, MIB006, C12orf6" in publications.

  5. What is the shipping cost for "PARP11 Antibody - middle region (ARP33767_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "PARP11 Antibody - middle region (ARP33767_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PARP11 Antibody - middle region (ARP33767_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "39kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PARP11 Antibody - middle region (ARP33767_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PARP11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PARP11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PARP11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PARP11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PARP11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PARP11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.