Phox2b Antibody - N-terminal region
Cat# ARP38407_P050-25UL
Size : 25ul
Marca : Aviva Systems Biology
Phox2b Antibody - N-terminal region (ARP38407_P050)
| Datasheets/Manuals | Printable datasheet for anti-Phox2b (ARP38407_P050) antibody |
|---|
| Tested Species Reactivity | Rat |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phox2b |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-Phox2b (ARP38407_P050) antibody is Catalog # AAP38407 |
| Gene Symbol | Phox2b |
|---|---|
| Alias Symbols | NBPhox |
| NCBI Gene Id | 364152 |
| Description of Target | The function of this protein remains unknown. |
| Protein Accession # | XP_001077800 |
| Nucleotide Accession # | XM_001077800 |
| Protein Size (# AA) | 270 |
| Molecular Weight | 29kDa |




