Host species: Escherichia coli (E.coli) Origin species: Human Uniprot ID: Q9NQI0 Molecular weight: 12.96 kDa Asn35–Gly131 Datasheet Specifications Recombinant Human DDX4, N-His Product name ARO-P13069-100 Uniprot ID Q9NQI0 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG Molecular weight 12.96 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Asn35-Gly131 Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4 Reference ARO-P13069 Note For research use only. Molecular Constructor Asn35–Gly131 Product name ARO-P13069-1MG Uniprot ID Q9NQI0 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG Molecular weight 12.96 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Asn35-Gly131 Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4 Reference ARO-P13069 Note For research use only. Molecular Constructor Asn35–Gly131 Product name ARO-P13069-50 Uniprot ID Q9NQI0 Origin species Human Expression system Prokaryotic expression Raw Antigen Sequence NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRG Molecular weight 12.96 kDa Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. Delivery condition Dry Ice Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Asn35-Gly131 Aliases /Synonyms DDX4, VASA, Vasa homolog, DEAD box protein 4, Probable ATP-dependent RNA helicase DDX4 Reference ARO-P13069 Note For research use only. Molecular Constructor Asn35–Gly131 Documents Datasheet 3D Representation Reviews There are no reviews yet. Be the first to review “Recombinant Human DDX4, N-His” Cancel reply
There are no reviews yet.