Recombinant Human PLCZ1, N-GST

Cat# NB-21-30640

Size : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q86YW0
Molecular weight:
38.50 kDa
Ser469–Thr572

Specifications Recombinant Human PLCZ1, N-GST

Product name ARO-P12894-100
Uniprot ID Q86YW0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight 38.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser469-Thr572
Aliases /Synonyms 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference ARO-P12894
Note For research use only.
Molecular Constructor
Ser469–Thr572
Product name ARO-P12894-1MG
Uniprot ID Q86YW0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight 38.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser469-Thr572
Aliases /Synonyms 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference ARO-P12894
Note For research use only.
Molecular Constructor
Ser469–Thr572
Product name ARO-P12894-50
Uniprot ID Q86YW0
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
Molecular weight 38.50 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser469-Thr572
Aliases /Synonyms 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1, PLCZ1, Testis-development protein NYD-SP27, Phospholipase C-zeta-1, Phosphoinositide phospholipase C-zeta-1, PLC-zeta-1
Reference ARO-P12894
Note For research use only.
Molecular Constructor
Ser469–Thr572

Documents

3D Representation

Recombinant Human PLCZ1, N-GST

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human PLCZ1, N-GST” Cancel reply

Related products

  • PTX20440

    Anti-Human PLCZ1 Polyclonal Antibody