Recombinant Mouse C-X-C motif chemokine 2 protein
Cat# OPCA00803-1MG
Size : 1mg
Marca : Aviva Systems Biology
CXCL2 Recombinant Protein (Mouse) (OPCA00803)
| Datasheets/Manuals | Printable datasheet for CXCL2 Recombinant Protein (Mouse) (OPCA00803) |
|---|
| Predicted Species Reactivity | Mouse|Mus musculus |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Protein Sequence | AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 28-100 aa |
| Tag | N-terminal 6xHis-tagged |
| Reference | Cloning and characterization of cDNAs for murine macrophage inflammatory protein 2 and its human homologues.Tekamp-Olson P., Gallegos C., Bauer D., McClain J., Sherry B., Fabre M., van Deventer S., Cerami A.J. Exp. Med. 172:911-919(1990) |
|---|---|
| Gene Symbol | Cxcl2 |
| Gene Full Name | chemokine (C-X-C motif) ligand 2 |
| Alias Symbols | C-X-C motif chemokine 2, CINC, CINC-2a, Gr, Gro2, GROb, macrophage inflammatory protein 2, Mgsa, Mgsa-b, Mi, MIP, MIP-2, MIP-2a, Mip2, Scy, Scyb, Scyb2, small inducible cytokine subfamily, member 2. |
| NCBI Gene Id | 20310 |
| Protein Name | C-X-C motif chemokine 2 |
| Description of Target | Chemotactic for human polymorphonuclear leukocytes but does not induce chemokinesis or an oxidative burst. |
| Uniprot ID | P10889 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 11.8 kDa |
