Reagenti e strumenti per immunologia, biologia cellulare e biologia molecolare
 
> Fam40a Blocking peptide (N termianl region)

Fam40a Blocking peptide (N termianl region)

Stampa Stampa
Entra

Cat# AAP95350

Size : 100ug

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

STRIP1 Peptide - N-terminal region (AAP95350)

Data Sheet
 
Sku AAP95350
99
Name STRIP1 Peptide - N-terminal region (AAP95350)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene STRIP1
Alias symbols Fam40a, 6330569M22Rik, 6530401O14Rik
Gene id 229707
Swissprot id Q8C079
Protein accession num NP_705791.2
Nucleotide accession num NM_153563.2
Protein size 837 amino acids
Molecular weight 92 kDa
Species reactivity Mouse
Peptide sequence Synthetic peptide located within the following region: PGAPRAAGGLLPGGKAREFNRNQRKDSEGYSESPDLEFEYADTDKWAAEL
Quality control The peptide is characterized by mass spectroscopy
Description This is a synthetic peptide designed for use in combination with anti- FAM40A Antibody (ARP95350_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery International: 3-5 business days
Protocol
  • Reconstitution Instructions
  • Immunohistochemistry (IHC) Protocol
  • Immunocytochemistry (ICC) Protocol
  • Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
  • Western Blotting/Immunoblotting (WB/IB) Protocol
  • Blocking Peptide Competition Protocol (BPCP)
  • Immunoprecipitation (IP) Protocol
Tips
  • IHC Tips & Tricks
  • ICC Tips & Tricks
  • ELISA Tips & Tricks
  • WB/IB Tips & Tricks
  • IP Tips & Tricks

See our General FAQ page.
Availability In Stock
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

This product is for Research Use Only. Not for diagnostic, human, or veterinary use.
Optimal conditions of its use should be determined by end users.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com