Size : 100ug
| Product name | synthetic construction IA-2 Recombinant Protein |
|---|---|
| Uniprot ID | Q7KZS4 |
| Uniprot link | http://www.uniprot.org/uniprot/Q7KZS4 |
| Origin species | synthetic construction |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MAHNHRHKHKLLEVLFQGPHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN |
| Molecular weight | 44.72kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 95% |
| Buffer | Tris 50mMHCl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH 7 |
| Form | Lyophilized |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 2-3 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Partial |
| Protein Accession | AAP36361.1 |
| Spec:SwissProtID | Q7KZS4 |
| NCBI Reference | AAP36361.1 |
| Aliases /Synonyms | IA-2, Protein-tyrosine-phosphatase |
| Reference | PX-P2076 |
| Note | For research use only |
| Molecular Constructor | Partial Yes |