synthetic construction IA-2 Recombinant Protein

Cat# NB-21-25205

Size : 50ug

Marca : Neo Biotech


synthetic construction IA-2 Recombinant Protein

Product name synthetic construction IA-2 Recombinant Protein
Uniprot ID Q7KZS4
Uniprot link http://www.uniprot.org/uniprot/Q7KZS4
Origin species synthetic construction
Expression system Prokaryotic expression
Raw Antigen Sequence MAHNHRHKHKLLEVLFQGPHARQQDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQFSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQAEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAYIATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGASLYHVYEVN
Molecular weight 44.72kDa
Protein delivered with Tag? Yes
Purity estimated 95%
Buffer Tris 50mMHCl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH 7
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 2-3
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession AAP36361.1
Spec:SwissProtID Q7KZS4
NCBI Reference AAP36361.1
Aliases /Synonyms IA-2, Protein-tyrosine-phosphatase
Reference PX-P2076
Note For research use only
Molecular Constructor
Partial Yes