Images
Western Blot (Cell lysate)
Application

Western Blot (Cell lysate)

TEAD4 monoclonal antibody (M01J), clone 5H3. Western Blot analysis of TEAD4 expression in HeLa.

Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01J), clone 5H3.

Lane 1: TEAD4 transfected lysate (Predicted MW: 34.2 KDa).
Lane 2: Non-transfected lysate.

Immunoprecipitation
Application

Immunoprecipitation

Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.

Sandwich ELISA (Recombinant protein)
Application

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged TEAD4 is 0.1 ng/ml as a capture antibody.

RNAi Knockdown (Antibody validated)
Application

RNAi Knockdown (Antibody validated)

Western blot analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TEAD4 monoclonal antibody (M01), clone 5H3 (Cat # H00007004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

QC Test

Western Blot detection against Immunogen (37.84 KDa) .

  • Specification

    Product Description

    Mouse monoclonal antibody raised against a partial recombinant TEAD4.
    This product is belong to Cell Culture Grade Antibody (CX Grade).Cell Culture Grade Antibody,Cell Culture Grade Antibodies,Cell Culture Grade,CX Grade,CXGrade

    Immunogen

    TEAD4 (NP_003204, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

    Sequence

    ARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDP

    Host

    Mouse

    Reactivity

    Human

    Preparation Method

    Cell Culture Production

    Isotype

    IgG2a Kappa

    Quality Control Testing

    Antibody Reactive Against Recombinant Protein.

    Western Blot detection against Immunogen (37.84 KDa) .

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Cell lysate)

    TEAD4 monoclonal antibody (M01J), clone 5H3. Western Blot analysis of TEAD4 expression in HeLa.

    Western Blot (Transfected lysate)

    Western Blot analysis of TEAD4 expression in transfected 293T cell line by TEAD4 monoclonal antibody (M01J), clone 5H3.

    Lane 1: TEAD4 transfected lysate (Predicted MW: 34.2 KDa).
    Lane 2: Non-transfected lysate.

    Western Blot (Recombinant protein)

    Immunoprecipitation

    Immunoprecipitation of TEAD4 transfected lysate using anti-TEAD4 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with TEAD4 MaxPab rabbit polyclonal antibody.

    Sandwich ELISA (Recombinant protein)

    Detection limit for recombinant GST tagged TEAD4 is 0.1 ng/ml as a capture antibody.

    ELISA

    RNAi Knockdown (Antibody validated)

    Western blot analysis of TEAD4 over-expressed 293 cell line, cotransfected with TEAD4 Validated Chimera RNAi ( Cat # H00007004-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TEAD4 monoclonal antibody (M01), clone 5H3 (Cat # H00007004-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • Gene Info — TEAD4

    Entrez GeneID

    7004

    GeneBank Accession#

    NM_003213

    Protein Accession#

    NP_003204

    Gene Name

    TEAD4

    Gene Alias

    EFTR-2, MGC9014, RTEF1, TCF13L1, TEF-3, TEFR-1, hRTEF-1B

    Gene Description

    TEA domain family member 4

    Omim ID

    601714

    Gene Ontology

    Hyperlink

    Gene Summary

    This gene product is a member of the transcriptional enhancer factor (TEF) family of transcription factors, which contain the TEA/ATTS DNA-binding domain. It is preferentially expressed in the skeletal muscle, and binds to the M-CAT regulatory element found in promoters of muscle-specific genes to direct their gene expression. Alternatively spliced transcripts encoding distinct isoforms, some of which are translated through the use of a non-AUG (UUG) initiation codon, have been described for this gene. [provided by RefSeq

    Other Designations

    related transcription enhancer factor 1B|transcription factor 13-like 1|transcriptional enhancer factor 1-related|transcriptional enhancer factor 3

  • Interactome