TMEPAI (PMEPA1) (NM_199170) Human Recombinant Protein

Cat# TP320162

Size : 20ug


TMEPAI (PMEPA1) (NM_199170) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320162
Recombinant protein of human prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 3, 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220162 representing NM_199170
Red=Cloning site Green=Tags(s)

MMVMVVVITCLLSHYKLSARSFISRHSQGRRREDALSSEGCLWPSESTVSGNGIPEPQVYAPPRPTDRLA
VPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRT
IFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTR
LHHTHIAPLESAAIWSKEKDKQKGHPL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 26 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_954639
Locus ID 56937
UniProt ID Q969W9
Cytogenetics 20q13.31
RefSeq Size 4531
RefSeq ORF 711
Synonyms STAG1; TMEPAI
Summary This gene encodes a transmembrane protein that contains a Smad interacting motif (SIM). Expression of this gene is induced by androgens and transforming growth factor beta, and the encoded protein suppresses the androgen receptor and transforming growth factor beta signaling pathways though interactions with Smad proteins. Overexpression of this gene may play a role in multiple types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. provided by RefSeq, Dec 2011
Protein Categories Growth Factors, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
SKU Description Size
PH310261 PMEPA1 MS Standard C13 and N15-labeled recombinant protein (NP_954640) 10 ug
PH320162 PMEPA1 MS Standard C13 and N15-labeled recombinant protein (NP_954639) 10 ug
LC404671 Lyophilized PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC404672 Lyophilized PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC412605 Lyophilized PMEPA1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY404671 Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 3 (as WB positive control) 100 ug
LY404672 Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 4 (as WB positive control) 100 ug
LY412605 Transient overexpression lysate of prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 1 (as WB positive control) 100 ug
TP310261 Recombinant protein of human prostate transmembrane protein, androgen induced 1 (PMEPA1), transcript variant 4, 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced