TRIM65 Protein, Human, Recombinant (His)
Cat# TMPH-03777-5ug
Size : 5ug
Marca : TargetMol
TRIM65 Protein, Human, Recombinant (His)
(Synonyms: Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65) Copy Product InfoTRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
Select Batch
Purity:88%
Appearance:Lyophilized powder
Color:Transparent
COAUser Guide of Recombinant Proteins
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69. |
| Species | Human |
| Expression System | Yeast |
| Tag | C-6xHis |
| Accession Number | P43003 |
| Amino Acid | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
| Construction | 146-236 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. ![]() |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65 |
| Molecular Weight | 64.1 kDa (Predicted); 66 kDa (Reducing conditions) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |



