Reagenti e strumenti per immunologia, biologia cellulare e biologia molecolare
 
> Anti-Human GATA2 Polyclonal Antibody

Anti-Human GATA2 Polyclonal Antibody

Stampa Stampa
Entra

Cat# NB-21-37813

Size : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Anti-Human GATA2 Polyclonal Antibody binds to Recombinant Human GATA2, N-His in WB Assay

Specifications Anti-Human GATA2 Polyclonal Antibody

Product name ARO-A11715-100
Uniprot ID P23769
Raw Antigen Sequence PTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GATA2, GATA-binding protein 2, Endothelial transcription factor GATA-2
Reference ARO-A11715
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human GATA2 (Pro175-Gly480).
Product name ARO-A11715-1MG
Uniprot ID P23769
Raw Antigen Sequence PTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GATA2, GATA-binding protein 2, Endothelial transcription factor GATA-2
Reference ARO-A11715
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human GATA2 (Pro175-Gly480).
Product name ARO-A11715-50
Uniprot ID P23769
Raw Antigen Sequence PTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-GATA2, GATA-binding protein 2, Endothelial transcription factor GATA-2
Reference ARO-A11715
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Human GATA2 (Pro175-Gly480).

Documents

QC & Validation

Anti-Human GATA2 Polyclonal Antibody binds to Recombinant Human GATA2, N-His in WB Assay

Anti-Human GATA2 Polyclonal Antibody binds to Recombinant Human GATA2, N-His in WB Assay

Recombinant Human GATA2, N-His(cat. No.ARO-P13917) can bind Anti-Human GATA2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human GATA2 Polyclonal Antibody” Cancel reply

Related products

  • ARO-P13917

    Recombinant Human GATA2, N-His