Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Cat# NB-21-23101

Size : 100ug

Marca : Neo Biotech


Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein

Product name Chinese sturgeon Luteinizing hormone(Luteinizing) Recombinant Protein
Uniprot ID B2CKR4
Uniprot link http://www.uniprot.org/uniprot/B2CKR4
Origin species Chinese sturgeon
Expression system Eukaryotic expression
Raw Antigen Sequence MPASMPLLLLLFSALILSHSSSLRLCEPVNETISAEKEECPKCLLIQTSICSGSCPTKDPVFKSALSTVQQHVCTYKDLRFVTVTLPDCPPGVDPHFTFPLALSCECSLCRMESSDCTIQSVGPSDCMSGELAIQNYDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight 40.94 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer PBS, pH 7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Host species Mammalian cells
Fragment Type Full-length
NCBI Reference B2CKR4
Aliases /Synonyms ICSH, Lutropin, Interstitial Cell Stimulating Hormone
Reference PX-P3017
Note For research use only
Molecular Constructor
Full-length Yes