Glp-amyloid-β (3-40) peptide (human) [161818-04-8]
Cat# HY-P4885
Size : Onrequest
Marca : MedChemExpress
| Description |
Glp-Amyloid-β (3-40) Peptide (human) (AβpE3-40) is a minor amounts of pyroglutamate-modified Aβ isolated from from 24-month-old Amyloid precursor protein (APP) transgenic Mice[1]. |
|---|---|
| Masse moléculaire |
4125.62 |
| Formule |
C187H283N51O53S |
| CAS No. | |
| Sequence |
{Pyr}-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Sequence Shortening |
{Pyr}-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Livraison | Room temperature in continental US; may vary elsewhere. |
| Stockage |
Please store the product under the recommended conditions in the Certificate of Analysis. |
| Pureté et documentation | |
| Références |

