Immunofluorescence
Immunofluorescence of monoclonal antibody to HTT on HeLa cell . [antibody concentration 10 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HD is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.84 KDa) .
- Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant HD.
Immunogen
HD (NP_002102, 81 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AVAEEPLHRPKKELSATKKDRVNHCLTICENIVAQSVRNSPEFQKLLGIAMELFLLCSDDAESDVRMVADECLNKVIKALMDSNLPRLQLELYKEIKKNGAPRSLRAALW
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- Applications
Immunofluorescence
Immunofluorescence of monoclonal antibody to HTT on HeLa cell . [antibody concentration 10 ug/ml]ELISA
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HD is approximately 0.03ng/ml as a capture antibody.Western Blot (Recombinant protein)
- Gene Info — HTT
- Interactomes
- Diseases
- Publication Reference
- N-terminal mutant huntingtin deposition correlates with CAG repeat length and symptom onset, but not neuronal loss in Huntington's disease.
Florence E Layburn, Adelie Y S Tan, Nasim F Mehrabi, Maurice A Curtis, Lynette J Tippett, Clinton P Turner, Nathan Riguet, Lorène Aeschbach, Hilal A Lashuel, Mike Dragunow, Richard L M Faull, Malvindar K Singh-Bains.
Neurobiology of Disease 2022 Nov; 174:105884.
Application：IHC, Human, Human brain tissue.
- N-terminal mutant huntingtin deposition correlates with CAG repeat length and symptom onset, but not neuronal loss in Huntington's disease.