Human Excitatory amino acid transporter 4 (SLC1A6) Recombinant Protein
Cat# orb1650072-1mg
Size : 1mg
Marca : Biorbyt
Human Excitatory amino acid transporter 4 (SLC1A6) Recombinant Protein
SKU: orb1650072
Description
Images & Validation
−
Key Properties
−| Species/Host | E. coli |
|---|---|
| Immunogen | Expression Region:149-271aa; Sequence Info:Partial |
| Tag | N-terminal GST-tagged |
| MW | 40.4 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months at -20°C,-80°C. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
|---|---|
| Buffer/Preservatives | Tris-based buffer50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Sodium-dependent glutamate,aspartate transporter Solute carrier family 1 member 6
−
Human SLC1A6 Recombinant Protein (N-GST & C-His) [orb3149656]
ELISA, SDS-PAGE, WB
>90% as determined by SDS-PAGE.
40.32 kDa
50 μg, 100 μg, 1 mg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide