INMT (NM_006774) Human Recombinant Protein

Cat# TP318678

Size : 20ug


INMT (NM_006774) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318678
Recombinant protein of human indolethylamine N-methyltransferase (INMT), 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218678 representing NM_006774
Red=Cloning site Green=Tags(s)

MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQ
VLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLK
CDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKRE
FSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 28.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006765
Locus ID 11185
UniProt ID O95050
Cytogenetics 7p14.3
RefSeq Size 2639
RefSeq ORF 789
Synonyms TEMT
Summary N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera. provided by RefSeq, Jul 2019
Protein Categories Intracellular Proteins
Protein Pathways Tryptophan metabolism
SKU Description Size
PH318678 INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765) 10 ug
LC416430 Lyophilized INMT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY416430 Transient overexpression lysate of indolethylamine N-methyltransferase (INMT) (as WB positive control) 100 ug
TP761226 Purified recombinant protein of Human indolethylamine N-methyltransferase (INMT), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced