MARVELD3 antibody - middle region
Cat# ARP44715_P050
Size : 100ul
Marca : Aviva Systems Biology
MARVELD3 Antibody - middle region (ARP44715_P050)
| Datasheets/Manuals | Printable datasheet for anti-MARVELD3 (ARP44715_P050) antibody |
|---|
| Publications | α-Synuclein pre-formed fibrils impair tight junction protein expression without affecting cerebral endothelial cell function |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Additional Information | IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.25 ug/ml. Gel concentration: 12%. |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MARVELD3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MARVELD3 (ARP44715_P050) antibody is Catalog # AAP44715 (Previous Catalog # AAPP12187) |
| Reference | Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
|---|---|
| Gene Symbol | MARVELD3 |
| Gene Full Name | MARVEL domain containing 3 |
| Alias Symbols | MARVD3, MRVLDC3 |
| NCBI Gene Id | 91862 |
| Protein Name | MARVEL domain-containing protein 3 |
| Description of Target | The function remains unknown. |
| Uniprot ID | A8K820 |
| Protein Accession # | NP_001017967 |
| Nucleotide Accession # | NM_001017967 |
| Protein Size (# AA) | 410 |
| Molecular Weight | 46kDa |
| Protein Interactions | UBC; |


