Mopeia virus Pre-GP-C Protein (hFc)
Cat# NB-64-127808-1mg
Size : 1mg
Marca : Neo Biotech
Remove All
Mopeia virus Pre-GP-C Protein (hFc)
(Synonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC) Copy Product InfoSynonyms: Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC
Catalog No. TMPH-04514 Copy Product Info
Mopeia virus Pre-GP-C Protein (hFc) is expressed in Mammalian cell. The accession number is P19240.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Mopeia virus Pre-GP-C Protein (hFc) is expressed in Mammalian cell. The accession number is P19240. |
| Species | Mopeia virus (MOPV) |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P19240 |
| Amino Acid | SIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVD |
| Construction | 59-430 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Pre-GP-C, Pre-glycoprotein polyprotein GP complex, GP-C, GPC |
| Molecular Weight | 71.6 kDa (Predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
PreGPC
Related Tags: Mopeia virus Pre-GP-C Protein (hFc) chemical structure | Mopeia virus Pre-GP-C Protein (hFc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

