Recombinant EGF (Epidermal growth factor), Human, AF
Cat# orb1179132-500ug
Size : 500ug
Marca : Biorbyt
Recombinant EGF (Epidermal growth factor), Human, AF
Catalog Number: orb1179132
Catalog Number | orb1179132 |
---|---|
Category | Proteins |
Description | Recombinant EGF (Epidermal growth factor), Human, AF |
Tested applications | ELISA |
Reactivity | Human |
Tag | His-tag at the N-terminus |
Form/Appearance | Lyophilized |
Purity | > 95% as determined by SDS-PAGE. Ni-NTA chromatography. |
Entrez | 1950 |
Protein Sequence | MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRLE with polyhistidine tag at the C-terminus. |
Source | Escherichia coli |
Biological Activity | Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 0.05-0.12 ng/mL. The specific activity of recombinant human EGF is approximately > 1.4 x 106 IU/mg. |
Endotoxins | < 0.1 EU per 1 μg of the protein by the LAL method. |
Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Alternative names | Urogastrone, URG |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |